PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK23594.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 136aa    MW: 16065.2 Da    PI: 11.3755
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK23594.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.6e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed llv++++++G g+W+ ++++ g+ R++k+c++rw +yl
        PK23594.1 14 RGPWTPREDTLLVNYIQLHGEGHWRIVPKKAGLLRCGKSCRLRWMNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding53.84.6e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T++Ed+l+++++ +lG++ W++Ia +++ gRt++++k++w+++l
        PK23594.1  67 RGNITADEDDLIIRLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.296961IPR017930Myb domain
SuperFamilySSF466894.03E-3111108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002496.3E-161461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.9E-241568IPR009057Homeodomain-like
CDDcd001674.55E-101661No hitNo description
PROSITE profilePS5129426.16462116IPR017930Myb domain
SMARTSM007178.0E-1666114IPR001005SANT/Myb domain
PfamPF002492.2E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2669116IPR009057Homeodomain-like
CDDcd001674.75E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
MGRTACCSRF GLRRGPWTPR EDTLLVNYIQ LHGEGHWRIV PKKAGLLRCG KSCRLRWMNY  60
LRPDIKRGNI TADEDDLIIR LHSLLGNRWS LIAGRLPGRT DNEIKNYWNS HLSKRLNTNN  120
KERTKKKQQR QQQQQX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121185110B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015896010.14e-76PREDICTED: myb-related protein 308-like
SwissprotQ7XBH46e-62MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA2Q1251e-83A2Q125_HUMLU; Putative transcription factor
STRINGPOPTR_0001s11100.11e-74(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.15e-62myb domain protein 5