PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK23483.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Trihelix
Protein Properties Length: 310aa    MW: 36165.6 Da    PI: 6.5523
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK23483.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix81.31.4e-2527109186
   trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                +W+ qe+++L+ +r e ++++ ++k++k lWe +s++m+e+gf+rsp+qCk+kw+nl +ryk ++++e +    +++++p++++++
  PK23483.1  27 QWSLQETKELLIIRAEFDQTFMETKRNKLLWEVISNRMKEKGFNRSPEQCKCKWKNLVTRYKGCETMEAEV---VRQQFPFYNEVQ 109
                7********************************************************************96...67789***9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00282486IPR001005SANT/Myb domain
CDDcd122033.02E-242691No hitNo description
PfamPF138371.9E-1927111No hitNo description
PROSITE profilePS500907.6892884IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
NAKKDNNNNN SNNNSSVSLD VTDRFPQWSL QETKELLIIR AEFDQTFMET KRNKLLWEVI  60
SNRMKEKGFN RSPEQCKCKW KNLVTRYKGC ETMEAEVVRQ QFPFYNEVQA IFSARIQMRS  120
MWAEPELGSV GGGGGGLKKQ KGVMIMSSDD ELEDINNNNI IVHDNIDHVI SEEGEQKGNI  180
NNSSGTILRS NNKKMKSSNK VMISDHVGSS GSSSSGIVNN VREILEDFMK QQMAMETQWR  240
EAFEAREEER RLKELEWRQT MEALENERLL MERRWREREE QRRIREEARA DKRDALITAL  300
LNKLTRDHDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A4e-1324107386DNA binding protein GT-1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104264.11e-108Trihelix transcription factor GT-3b
SwissprotQ9SDW05e-67TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLW9RYU51e-108W9RYU5_9R
STRINGGLYMA18G43190.25e-99(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.16e-53Trihelix family protein