PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK23009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 256aa    MW: 28201.3 Da    PI: 7.5847
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK23009.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof105.72.5e-331481461
     zf-Dof 14 tntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
               ++tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvP+G+grrknk+ 
  PK23009.1  1 METKFCYFNNYNVNQPRHFCKNCQRYWTAGGSMRNVPIGAGRRKNKHL 48
               68********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088424.176147IPR003851Zinc finger, Dof-type
PfamPF027011.1E-25147IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-21146IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
METKFCYFNN YNVNQPRHFC KNCQRYWTAG GSMRNVPIGA GRRKNKHLAS QFRQIMASGE  60
GARITSSSDE PSNGKVLTFC HNGDDSSLEG NVTEQHAARS HPPQQCYPVV SWDPTQHSHQ  120
QFVVSNPSDS SQVQWLEAPV LSVPTTVPIQ FVQAASYWGC MPIWAAAQAR GNVSVLPALG  180
KHSREESEEG VLASSEASKN QIQGGLGFEF EKENSVYKKL AHSKIEGKDN VLYSSSPVLE  240
ANPAAISRSH SFQEST
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021282282.15e-60cyclic dof factor 3-like
TrEMBLA0A2P5XL763e-55A0A2P5XL76_GOSBA; Uncharacterized protein
STRINGevm.model.supercontig_161.442e-58(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2557323
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69570.12e-36Dof family protein