PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK22876.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Trihelix
Protein Properties Length: 295aa    MW: 34943.9 Da    PI: 6.0636
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK22876.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix72.95.6e-2332113186
   trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                +W ++e+++ i++r+e+e+++  +k+ k lW++vs+km ergf r++ qCk+kw+nl +ryk  ++++ ++     ++cp+f++l+
  PK22876.1  32 QWGQEETKEFIKIRTELERDSALTKRSKVLWDAVSSKMLERGFIRTSDQCKCKWKNLLNRYKGQETSDPEN----GRQCPFFEELH 113
                7**************************************************************99999974....678******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500908.0142589IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.607.0E-43090IPR009057Homeodomain-like
PfamPF138374.7E-2132115No hitNo description
CDDcd122032.14E-193294No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
XYEWGDDEGR RTTTSTRTMM VMMGRSAQGQ GQWGQEETKE FIKIRTELER DSALTKRSKV  60
LWDAVSSKML ERGFIRTSDQ CKCKWKNLLN RYKGQETSDP ENGRQCPFFE ELHALFSERE  120
KNMQRLLLET EMGSPRSRKK MKGPSNAGQS SDEFSENEEN DKEGIDEETP TTTTSTRRKR  180
KGEKIALDKS LKATNAAAAA SMSGETDIRE MLKQFFEQQQ MIEKQWMDMM DRRAYEQQLF  240
EQEWRQSMEK LERERLMVEQ SWREREEQRR IREESRAERR DALLTSLLNN LLHEN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010112997.11e-128Trihelix transcription factor GT-3b
TrEMBLW9SMK51e-128W9SMK5_9R
STRINGVIT_02s0087g00140.t013e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.11e-26Trihelix family protein