PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK22320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family SBP
Protein Properties Length: 187aa    MW: 21356.1 Da    PI: 9.9804
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK22320.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.14.6e-4264140177
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                +Cq+e+C+adls+ak+yhrrhkvCe+h+ka+vvlvsg++qrfCqqCsrfhelsefDe++rsCrrrLa+hnerrrk++
  PK22320.1  64 CCQAEKCSADLSDAKQYHRRHKVCEIHAKAQVVLVSGIRQRFCQQCSRFHELSEFDETRRSCRRRLAGHNERRRKSS 140
                6**************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.2E-3357126IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.41962139IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.28E-3863142IPR004333Transcription factor, SBP-box
PfamPF031103.6E-3265138IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MELGKIERNK RMTVSGKEKM VVKREDEDED ESSEQEDKRK KGLLVLGVGV GSGKKGSSGA  60
GMRCCQAEKC SADLSDAKQY HRRHKVCEIH AKAQVVLVSG IRQRFCQQCS RFHELSEFDE  120
TRRSCRRRLA GHNERRRKSS GESHQESSSR KGTATQLKDM VCGQIDERGR IQISVQENNS  180
YKHFQIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-3956138184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBM25215497Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010091480.19e-77Squamosa promoter-binding-like protein 5
SwissprotQ9S7A95e-48SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBLQ52UU13e-77Q52UU1_BETPL; Squamosa promoter binding-like protein
STRINGVIT_12s0028g03350.t016e-74(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.28e-42squamosa promoter binding protein-like 4