PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK21617.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family LBD
Protein Properties Length: 95aa    MW: 10420.8 Da    PI: 9.5457
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK21617.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26062.69.9e-205095146
     DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkll 46
               +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l
  PK21617.1 50 PCAACKLLRRRCAEECPFSPYFSPQEPQKFAAVHKVFGASNVSKML 95
               7*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089116.8044995IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-195095IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
XSVVLLPPPN NINNNININI SDHHQNQIMG RRLVQSFGPA AAGTLNTITP CAACKLLRRR  60
CAEECPFSPY FSPQEPQKFA AVHKVFGASN VSKML
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589291.11e-36PREDICTED: LOB domain-containing protein 15-like
RefseqXP_016436404.11e-36PREDICTED: LOB domain-containing protein 15-like
SwissprotQ8L5T52e-31LBD15_ARATH; LOB domain-containing protein 15
SwissprotQ9AT613e-31LBD13_ARATH; LOB domain-containing protein 13
TrEMBLM1CZR79e-35M1CZR7_SOLTU; Uncharacterized protein
TrEMBLM1CZR81e-34M1CZR8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000782653e-34(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.18e-33LOB domain-containing protein 15