PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK21537.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 247aa    MW: 28108.8 Da    PI: 8.8286
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK21537.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding605.3e-194693148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd+ l+++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
        PK21537.1 46 RGPWTVEEDLTLINYIAIHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 93
                     89********************************************97 PP

2Myb_DNA-binding51.81.8e-1699142146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
        PK21537.1  99 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 142
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.8674197IPR017930Myb domain
SuperFamilySSF466894.12E-3143140IPR009057Homeodomain-like
SMARTSM007176.1E-164595IPR001005SANT/Myb domain
PfamPF002495.1E-174693IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-2347100IPR009057Homeodomain-like
CDDcd001674.67E-124893No hitNo description
PROSITE profilePS5129418.70798148IPR017930Myb domain
SMARTSM007171.3E-1498146IPR001005SANT/Myb domain
PfamPF002493.7E-1599142IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-23101147IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MEEEDQGLQQ QQQQQQXSSS NSSYNNNSSS DEQDHDQEMN NSDLRRGPWT VEEDLTLINY  60
IAIHGEGRWN SLARCAGLKR TGKSCRLRWL NYLRPDVRRG NITLEEQLLI LELHSRWGNR  120
WSKIAQHLPG RTDNEIKNYW RTRVQKHAKQ LKCDVNSKQF KDTMRYLWMP RLVERIQAAS  180
SSSSSTATPA SVGPTPATTS TTLPNNDNNI QFNAFLNNQS TPLPPPPPPS GSGIMPMVSS  240
NNNNNNN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-263714018120MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011027944.11e-104PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE18e-84MY108_ARATH; Transcription factor MYB108
TrEMBLK4C2131e-100K4C213_SOLLC; Uncharacterized protein
STRINGSolyc05g053330.2.11e-100(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.11e-84myb domain protein 78