PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK21510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family LBD
Protein Properties Length: 199aa    MW: 21560.1 Da    PI: 6.988
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK21510.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.27e-4412110199
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                +CaaCk+lrrkC ++C++apyfp e+p+k anvhk+FGasnv+kll++lp ++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el+++++
  PK21510.1  12 PCAACKFLRRKCMPGCIFAPYFPPEEPQKSANVHKIFGASNVTKLLNDLPSHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVHRLQKELDAANA 110
                7*********************************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.22911112IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4212109IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MASSSSSTYN SPCAACKFLR RKCMPGCIFA PYFPPEEPQK SANVHKIFGA SNVTKLLNDL  60
PSHQREDAVN SLAYEAEARV RDPVYGCVGA ISFLQRQVHR LQKELDAANA DLIRFACTEM  120
PPPPPLAPNV SDHHHLNNII HDHPMMSGPP RQGAGGGDSQ FYHHHPIGGG GGFSLPYNTT  180
SLPWSHDNIN EGGGGEGHL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003527004.16e-81PREDICTED: LOB domain-containing protein 25-like
RefseqXP_006581908.16e-81PREDICTED: LOB domain-containing protein 25-like
SwissprotQ9FML41e-71LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A0B2QCG36e-81A0A0B2QCG3_GLYSO; Protein LATERAL ORGAN BOUNDARIES
TrEMBLK7KVP46e-81K7KVP4_SOYBN; Uncharacterized protein
STRINGGLYMA06G18861.13e-80(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.49e-72LBD family protein