PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK20670.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 542aa    MW: 60481.9 Da    PI: 6.8215
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK20670.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS242.32e-741585342374
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                ++lL  cA+a+++g+  ++q+lL  l+elas +gd+++Rla++ ++AL ++l++s s  + a  + + s+ +     ++l  +sevsP++ f + ++N+ 
  PK20670.1 158 EQLLNPCATAITEGNCMRVQHLLYVLHELASLTGDANHRLAFHGLRALTHHLSSSPSVSAPAAGCVTFSTAEPRFFQKSLIKLSEVSPWFAFPNNITNSC 257
                689**************************************************95444455558888887777777777777****************** PP

       GRAS 102 Ileavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg......skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                Il+ +++e    + +Hi+D+++s+G+QWp Ll+aL+ R  ++pp +RiT ++  +++      +     +   rL  +A+++++++e+n l  + l++l+
  PK20670.1 258 ILQLLNEEndrtRSLHILDIGVSHGIQWPILLEALSRRLgGPPPLVRITIIAGTDQNndtafsKGPPGDNFSTRLLIYAKSININLEINRLDNQPLQNLN 357
                *****9998877889************************55666*****99886666678898888999*********************9999****** PP

       GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe..adh.nsesFlerflealeyysalfdsleaklpreseerikvEr 287
                 + ++ +++E+l+++ +++lh+l    +++++er+e+Lk++++++Pk ++++e++  +++ n ++F+ +f++++ey + +++s+++ +    + r + Er
  PK20670.1 358 AQIINSSEDETLIICAQFRLHHLN---HNTPNERTEFLKTLRKMEPKGIILSENNteCSCsNCGNFACGFSRKVEYLWRFLESTSSAF----KGRESEER 450
                ***********************8...77788889******************98445667889********************7775....77777888 PP

       GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                +l++ e+ + ++++g++    +e +ekW er++ aGF   +++e+a +  ++llrk++ ++++rvee++g + l Wk++p+ ++S W+
  PK20670.1 451 RLMEGEAAKGLTNRGEM----NEGKEKWCERMRGAGFMGESFGEEAIDGGRALLRKYDsNWEMRVEEKDGFVGLWWKGQPVSFCSLWK 534
                88888899999999988....9************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.562131513IPR005202Transcription factor GRAS
PfamPF035147.0E-72158534IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MDWLEDSVSF LPSFLDDPYQ SAEISGYPWW DERQDIIGHD LLHTINTSVY SPPTTATVTA  60
TATIITTTTS PPDSTISNLL PLPNSSKKRK TADGPIPKTS QNHHNPRKNQ GRQTNQVEDG  120
DTAVEEVVAV RKTVGNKRNS GKGAGNNNCN NKEGRWAEQL LNPCATAITE GNCMRVQHLL  180
YVLHELASLT GDANHRLAFH GLRALTHHLS SSPSVSAPAA GCVTFSTAEP RFFQKSLIKL  240
SEVSPWFAFP NNITNSCILQ LLNEENDRTR SLHILDIGVS HGIQWPILLE ALSRRLGGPP  300
PLVRITIIAG TDQNNDTAFS KGPPGDNFST RLLIYAKSIN INLEINRLDN QPLQNLNAQI  360
INSSEDETLI ICAQFRLHHL NHNTPNERTE FLKTLRKMEP KGIILSENNT ECSCSNCGNF  420
ACGFSRKVEY LWRFLESTSS AFKGRESEER RLMEGEAAKG LTNRGEMNEG KEKWCERMRG  480
AGFMGESFGE EAIDGGRALL RKYDSNWEMR VEEKDGFVGL WWKGQPVSFC SLWKLNHQPT  540
PT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-3315453484473Protein SHORT-ROOT
5b3h_B1e-3315453430419Protein SHORT-ROOT
5b3h_E1e-3315453430419Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010086812.10.0nodulation-signaling pathway 1 protein
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A2P5ETQ90.0A0A2P5ETQ9_TREOI; GRAS transcription factor
STRINGXP_010086812.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-158GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]