PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK20555.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 347aa    MW: 37915.6 Da    PI: 8.9872
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK20555.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.92.2e-3884144262
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                +++al+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lr +PvGgg+rknk+ss
  PK20555.1  84 HQQALNCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGSLRSIPVGGGSRKNKRSS 144
                6899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-2481136IPR003851Zinc finger, Dof-type
PfamPF027018.1E-3386142IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.81788142IPR003851Zinc finger, Dof-type
PROSITE patternPS01361090126IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MDTAHWPQEI VVKPIEEIIT NSCPKPHTNN IQASSSLSQG GKINNNNNNI INNNNNNTNL  60
VDMRSSSISK TSMMKPSSQN KDHHQQALNC PRCNSTNTKF CYYNNYSLTQ PRYFCKTCRR  120
YWTEGGSLRS IPVGGGSRKN KRSSPSSSSS SSKIIINSRL PDLVHNQLGQ AHQAHQAQAQ  180
TQAHDLNLGF YPPIINDQKI NHIISNPSSN TSPTSTTTTT TTTTNTSDHF SALELLTGLT  240
SRGFNSFFPI PDFKPSLNFS LDGLGPNTTS ATTTTSNTAS AYGSLPSVHE NNNSGSGRLL  300
FPFEDLKQVS SHNNNNNNSG IIDQNNNIIK ENGDSTGYWT GMLGGGW
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4881313e-43AM488131.2 Vitis vinifera contig VV78X232223.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010106133.17e-91dof zinc finger protein DOF4.6
TrEMBLA0A2P5F5245e-93A0A2P5F524_TREOI; Zinc finger transcription factor
STRINGXP_010106133.13e-90(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-39Dof family protein