PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK20392.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family HD-ZIP
Protein Properties Length: 273aa    MW: 30867.3 Da    PI: 7.2938
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK20392.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.89.1e-194597456
               -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               + +++ eq+++Le+ Fe+ +++  e++ +LAk lgL+ rqV +WFqNrRa++k
  PK20392.1 45 KKRLNLEQVKTLEKSFEMGNKLEPERKMQLAKALGLQPRQVAIWFQNRRARWK 97
               4568889*********************************************9 PP

2HD-ZIP_I/II130.37.5e-4243135193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekk+rl+ eqvk+LE+sFe+ +kLeperK++la++Lglqprqva+WFqnrRAR+ktkqlE+dy++Lk+++d lk++n++L++++++L+++l++
    PK20392.1  43 EKKKRLNLEQVKTLEKSFEMGNKLEPERKMQLAKALGLQPRQVAIWFQNRRARWKTKQLERDYDVLKKQFDLLKADNDSLQDQNNKLHQQLSS 135
                  69***************************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-1927100IPR009057Homeodomain-like
SuperFamilySSF466891.07E-1936101IPR009057Homeodomain-like
PROSITE profilePS5007117.1353999IPR001356Homeobox domain
SMARTSM003891.7E-1742103IPR001356Homeobox domain
CDDcd000862.30E-1544100No hitNo description
PfamPF000465.5E-164597IPR001356Homeobox domain
PRINTSPR000317.4E-67079IPR000047Helix-turn-helix motif
PROSITE patternPS0002707497IPR017970Homeobox, conserved site
PRINTSPR000317.4E-67995IPR000047Helix-turn-helix motif
PfamPF021831.2E-1499138IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
XNINTNNNSN KCNNNEDLLM LHGGGCGGGG EDELSDDGSQ LGEKKKRLNL EQVKTLEKSF  60
EMGNKLEPER KMQLAKALGL QPRQVAIWFQ NRRARWKTKQ LERDYDVLKK QFDLLKADND  120
SLQDQNNKLH QQLSSLKGSN DHHHQHQQQQ QHHDQYENFK KEAADQGSWS NGSSDQNSSD  180
VNLDISRPPL INTTTNTATT TTTSSANSSQ LVQNLFPSTL RPSSITQLLQ GSSSRSDFLN  240
NKHHSAAPPP PHHQHHHHQM VQSEESFCNL FVX
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19199RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007216284.23e-88homeobox-leucine zipper protein ATHB-20
SwissprotQ8S7W91e-60HOX21_ORYSJ; Homeobox-leucine zipper protein HOX21
TrEMBLA0A2P5D2281e-98A0A2P5D228_TREOI; Octamer-binding transcription factor
STRINGEMJ174831e-87(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.11e-52homeobox 3