PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK20358.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 223aa    MW: 26260.8 Da    PI: 4.9093
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK20358.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.4e-19552148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W++ ++  g+ R++k+c++rw +yl
        PK20358.1  5 KGPWTPEEDQILISYIHKYGHGNWRALPKLAGLLRCGKSCRLRWINYL 52
                     79******************************99************97 PP

2Myb_DNA-binding56.28.1e-1858103148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+e +++++++lG++ W++Ia++++ gRt++++k+ w+++l
        PK20358.1  58 RGNFTKEEEETIIELHQMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 103
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.59E-32199IPR009057Homeodomain-like
PROSITE profilePS5129426.85156IPR017930Myb domain
SMARTSM007171.6E-15454IPR001005SANT/Myb domain
PfamPF002491.1E-17552IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-26659IPR009057Homeodomain-like
CDDcd001671.70E-11752No hitNo description
SMARTSM007171.3E-1557105IPR001005SANT/Myb domain
PROSITE profilePS5129421.37857107IPR017930Myb domain
PfamPF002491.2E-1658103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2760107IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MGLKKGPWTP EEDQILISYI HKYGHGNWRA LPKLAGLLRC GKSCRLRWIN YLRPDIKRGN  60
FTKEEEETII ELHQMLGNRW SAIAARLPGR TDNEIKNVWH THLKKRLIIN NNDDVIIQKS  120
KRQRNHESYD DDNNIKIDDT KYDNDNNSNN DNLVVSSPPQ SSSSYDSFIS TDDQKFSETM  180
DDQFWTEVFS SESDENDHNN HEFDFTLTNS NNNVDYDQDM EFW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-3031075108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1118123KSKRQR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015891267.16e-79PREDICTED: myb-related protein Myb4
SwissprotQ7XBH47e-71MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLW9S9B07e-77W9S9B0_9R
STRINGGRMZM2G095904_P013e-76(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.11e-69myb domain protein 14