PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK19461.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 247aa    MW: 27789 Da    PI: 7.249
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK19461.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof90.11.8e-282441961
     zf-Dof 19 CyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
               Cyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rkn++ 
  PK19461.1  2 CYYNNYSLTQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRRG 44
               ****************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088422.974143IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-19243IPR003851Zinc finger, Dof-type
PfamPF027012.7E-22243IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
XCYYNNYSLT QPRYFCKGCR RYWTKGGSLR NVPVGGGCRK NRRGKSLRLS TATDGRTLLS  60
KNLNYGTTNN VSSTGVVGHN SYGGVNNNNG SFLDEYSNRS SNSMLQPDGS HIDLALVYAN  120
FLNQKPDNSK SNNNINGLEI PELGCDDHLI DQSNLEFISN TTNVNIQMAQ ELSTGNEQIY  180
NFCGLESFDH HKQYNNPDRT EHCVSDHFGL PPLPEQEVLW SSSSHHHHHH HLQHHQMMVS  240
QAIQATX
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010106991.12e-71dof zinc finger protein DOF3.5
TrEMBLA0A2P5ATX19e-96A0A2P5ATX1_TREOI; Zinc finger, Dof-type
STRINGXP_010106991.19e-71(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18173394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.17e-36Dof family protein