PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK18922.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family LBD
Protein Properties Length: 70aa    MW: 7668.46 Da    PI: 8.6723
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK18922.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26085.95.4e-271369157
     DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeereda 57
               +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l +++reda
  PK18922.1 13 PCAACKFLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELLPSQREDA 69
               7*****************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089119.9011270IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-261369IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
MASSSSSSSS NSPCAACKFL RRKCQPECVF APYFPPDQPQ KFANVHKVFG ASNVTKLLNE  60
LLPSQREDAX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010528622.15e-39PREDICTED: LOB domain-containing protein 6
SwissprotO044791e-40LBD6_ARATH; LOB domain-containing protein 6
TrEMBLA0A078IA776e-39A0A078IA77_BRANA; BnaA02g12180D protein
TrEMBLA0A0D3AN846e-39A0A0D3AN84_BRAOL; Uncharacterized protein
TrEMBLA7L4B28e-39A7L4B2_CARPA; Asymmetric leaves 2
TrEMBLM4FF616e-39M4FF61_BRARP; Uncharacterized protein
TrEMBLR0GIM56e-39R0GIM5_9BRAS; Uncharacterized protein
STRINGBra039733.1-P2e-38(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.46e-38LBD family protein