PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK17885.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRF
Protein Properties Length: 163aa    MW: 18590.9 Da    PI: 9.8738
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK17885.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.51.3e-2471114245
        WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                +ep+rCrRtDGKkWRCs+++l+ +k+CErH+hrgr+rsrk +e+
  PK17885.1  71 NEPWRCRRTDGKKWRCSKEALPHQKYCERHIHRGRHRSRKLVES 114
                79***************************************987 PP

2QLQ385.2e-14841336
        QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
               FT  Ql++L  Q+l+yKy+ a++ vP +L+q+i+
  PK17885.1  8 FTILQLHELQLQALIYKYIEAGLAVPYHLVQPIW 41
               7778*****************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.6E-4642IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.636742IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.1E-11841IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.52570114IPR014977WRC domain
PfamPF088791.7E-2072113IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
XSSSYHGFTI LQLHELQLQA LIYKYIEAGL AVPYHLVQPI WQSFSSTGLN NNGLGIVGPI  60
LCLDPRKGME NEPWRCRRTD GKKWRCSKEA LPHQKYCERH IHRGRHRSRK LVESSYTNSK  120
KTTMATATTT STTMTDLSIS LHVNENNATR STILFPSIDF QPN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298083.22e-47hypothetical protein POPTR_0001s08310g
SwissprotQ6AWX72e-38GRF12_ORYSJ; Growth-regulating factor 12
TrEMBLB9GKS43e-47B9GKS4_POPTR; Uncharacterized protein
STRINGPOPTR_0001s08310.17e-47(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF141951017
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.11e-31growth-regulating factor 2