PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK17790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family SBP
Protein Properties Length: 540aa    MW: 59053 Da    PI: 8.6727
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK17790.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1339.8e-42174249277
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                Cqv gC+++ls+ k+yh+rhkvCe hsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  PK17790.1 174 CQVYGCNKNLSSSKDYHKRHKVCELHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQ 249
                **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.7E-33168235IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.881171248IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.67E-38173252IPR004333Transcription factor, SBP-box
PfamPF031101.3E-31174247IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MEPWNFVSTE KGLASEETIS PFNSFARSKN VVMGWEFKTP CTYGNNLLLS CQQGIENQGF  60
GEYIQMMGKQ VSNNSIGDVL SDPKVCGGKL NDPAMAVAFS GEDESSSRIS SSILDSGSWD  120
PSLIDLKLGH VGDPRDTSKS KLSMGVVAGL SSSESSTPPK RLRLSAANPQ NGLCQVYGCN  180
KNLSSSKDYH KRHKVCELHS KTAKVIVNGI EQRFCQQCSR FHLLAEFDDG KRSCRKRLAG  240
HNERRRKPQV GIHSSRAGRM LQSYNDSRLQ GTASFICQDI LPSGFYSPQK YGTIDWTRRI  300
KAEDGSDLRL LSTAPVPGTN VHLSSKSLFP QDSGKQFPSF HASGANVVTT NVFSKNNIQY  360
PHDLGGPNSG SRPFFHKNIL GCGDFNTFNT GTTIQGFSGT SDSGCALSLL SSQFQSSSNH  420
FSGSSVVRPL VKPESHACYN MDQVSEKLVG ESSSCVSNRL LSPGTNSMSR SHMTSIMISD  480
GGDNVNFENG MFQGSDFPNS KYRISCAHSL TINLLQLSSQ LQRVEDQRQS MQVKRKDDAF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-291732471084squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015883292.10.0squamosa promoter-binding-like protein 6
TrEMBLA0A2P5EBT10.0A0A2P5EBT1_TREOI; SBP-box transcription factor
STRINGEMJ102990.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.13e-46SBP family protein