PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK17217.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family LBD
Protein Properties Length: 134aa    MW: 15033.2 Da    PI: 8.5085
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK17217.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601376.6e-43331321100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq+++l+ael+++++e
  PK17217.2  33 PCAACKLLRRRCAQECPFSPYFSPHEPHKFASVHKVFGASNVSKMLMEVPENQRADAANSLVYEANVRLRDPVYGCMGAISALQQQVQSLQAELNAVRAE 132
                7***********************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.84132133IPR004883Lateral organ boundaries, LOB
PfamPF031956.3E-4333130IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
QDPIFNHHHQ QQQQQMGRRH MLGPPGTLNT ITPCAACKLL RRRCAQECPF SPYFSPHEPH  60
KFASVHKVFG ASNVSKMLME VPENQRADAA NSLVYEANVR LRDPVYGCMG AISALQQQVQ  120
SLQAELNAVR AEIL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012091188.18e-84PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T54e-71LBD15_ARATH; LOB domain-containing protein 15
SwissprotQ9AT611e-70LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A067JNV99e-84A0A067JNV9_JATCU; Uncharacterized protein
STRINGVIT_13s0067g02380.t014e-83(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.18e-70LOB domain-containing protein 15