PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK16550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 248aa    MW: 27714.6 Da    PI: 7.1013
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK16550.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.2e-181055147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde+l  +vkq+  ++W+ I++ ++ gR++k+c++rw + 
        PK16550.1 10 KGPWSPEEDEKLQSLVKQHSARNWSVISKSIP-GRSGKSCRLRWCNQ 55
                     79******************************.***********985 PP

2Myb_DNA-binding57.33.6e-1864106347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+ Ed++++da+ ++G++ W+tIar +  gRt++ +k++w++ 
        PK16550.1  64 PFTAMEDQIIIDAHSKHGNK-WATIARLLE-GRTDNAIKNHWNST 106
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.46556IPR017930Myb domain
SuperFamilySSF466895.39E-317103IPR009057Homeodomain-like
SMARTSM007172.6E-15958IPR001005SANT/Myb domain
PfamPF002491.5E-171055IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-251163IPR009057Homeodomain-like
CDDcd001672.12E-141254No hitNo description
PROSITE profilePS5129425.96557111IPR017930Myb domain
SMARTSM007171.6E-1561109IPR001005SANT/Myb domain
CDDcd001671.38E-1164107No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2364110IPR009057Homeodomain-like
PfamPF002491.2E-1464106IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MESLLSRKVK GPWSPEEDEK LQSLVKQHSA RNWSVISKSI PGRSGKSCRL RWCNQLSPEV  60
KHRPFTAMED QIIIDAHSKH GNKWATIARL LEGRTDNAIK NHWNSTLKRK CSSSENDDGD  120
DDETSNPSRK RFASGGGGSD RPVSVQGNSC SSGGSESGSD DACDVISNET NFFPVYSQQL  180
LNRSLSPQEH VYNQSESFTD PFTQLTLSLP GSSTKSEKTN SLKFGPEFTR WLQETIRKEV  240
EDYMANIV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-3991136110B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010096284.11e-77Transcription factor
SwissprotQ9FDW15e-62MYB44_ARATH; Transcription factor MYB44
TrEMBLW9RBU51e-77W9RBU5_9R
STRINGPOPTR_0002s12410.16e-70(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.14e-61myb domain protein 73