PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK16315.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 237aa    MW: 26675.7 Da    PI: 10.6849
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK16315.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.8e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed +l +++k +G g W++ +++ g++R++k+c++rw++yl
        PK16315.1 14 RGAWTAMEDRILSEYIKVHGEGKWRSLPKRAGLKRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding52.51.1e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ +++E+el+++++++lG++ W++Ia +++ gRt++++k++w++
        PK16315.1  67 RGNISPDEEELIIRLHNLLGNR-WSLIAGRLP-GRTDNEIKNYWNT 110
                      7899******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.4E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.604961IPR017930Myb domain
SuperFamilySSF466892.62E-2812108IPR009057Homeodomain-like
SMARTSM007175.0E-131363IPR001005SANT/Myb domain
PfamPF002492.4E-141461IPR001005SANT/Myb domain
CDDcd001671.13E-91661No hitNo description
PROSITE profilePS5129424.37962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-2465116IPR009057Homeodomain-like
SMARTSM007172.6E-1566114IPR001005SANT/Myb domain
PfamPF002495.2E-1567110IPR001005SANT/Myb domain
CDDcd001673.93E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MGRSPCCSKE GLNRGAWTAM EDRILSEYIK VHGEGKWRSL PKRAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI SPDEEELIIR LHNLLGNRWS LIAGRLPGRT DNEIKNYWNT NIGKKVQVAA  120
DHHNNFLTKS NNNTTSRKAS SNIRCSSSST TTGRSLQQQQ LLVSTKLKTT STTTSAAADH  180
DHDHDQLQPS NKTNNNNNQG NSNVVRTVAT RCTKVVLLSQ TEAQNKALPP EHHHHHX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24121165108B-MYB
1h8a_C1e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010107990.12e-89Anthocyanin regulatory C1 protein
TrEMBLW9S6E42e-89W9S6E4_9R
STRINGGLYMA13G16890.12e-78(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.13e-62myb domain protein 3