PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK16254.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRF
Protein Properties Length: 429aa    MW: 46913 Da    PI: 8.7308
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK16254.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC81.85.9e-26154197144
        WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                d+epgrCrRtDGKkWRCsr+v+ g+k+CErH+hrgr+rsrk++e
  PK16254.1 154 DPEPGRCRRTDGKKWRCSRDVVVGQKYCERHMHRGRNRSRKPVE 197
                79***************************************987 PP

2QLQ49.81e-1778114137
        QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                s+F+ aQ+q+L+ Q+l+++y++a++ vP+eLlq+i+k
  PK16254.1  78 SYFSLAQWQELELQALIFRYMLAGATVPSELLQHIKK 114
                79*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.3E-1078114IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.95779114IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.9E-1279112IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.87154198IPR014977WRC domain
PfamPF088794.4E-22155197IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MEKQQHESEH HQQHSAKIPK LVIETHHMKQ DLSSTCSEPL PLFVPEPPNI TKMITTGTLS  60
TDSTTSPTTR IPRGGMGSYF SLAQWQELEL QALIFRYMLA GATVPSELLQ HIKKSFNLLN  120
TTPYFLHHSL QPYPHFQPSP TLLQSGYWGK ASMDPEPGRC RRTDGKKWRC SRDVVVGQKY  180
CERHMHRGRN RSRKPVEIPT PTTTTTGGGR LAGDGVGRGT LASNNGPSPL STSSNAAHFS  240
LSMPTSSIDL LHLNNRSNAS DVKNENKDLF KPHNEVSGDG KSDGHILRHF FDDWPRSLQE  300
SGNVEINNNN NNNNNNNNNR MRTSPMSSAS SLSISITGNN SSSTSDISLK LSTGGNGEEM  360
GHPEAHSDRQ QQSQLGWASS GWASNPMASM GGPLAEALRS SNSNSSSPTS VLHQLPPRSS  420
ASDTCIVST
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015901956.11e-151PREDICTED: growth-regulating factor 3
RefseqXP_015901955.11e-151PREDICTED: growth-regulating factor 3
TrEMBLW9R4371e-141W9R437_9R
STRINGVIT_08s0007g03760.t011e-133(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF78953242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.12e-56growth-regulating factor 4