PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK15647.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family LBD
Protein Properties Length: 85aa    MW: 9212.19 Da    PI: 7.6133
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK15647.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26056.11.1e-1726842381
     DUF260 23 paeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81
               p++q++++ +v+k+FG++ ++++++a+p+++r+++++sl+yeA  r+ +Pv+Gavg+++
  PK15647.1 26 PQAQAHATLFVAKFFGRAGLMSFISAVPQHHRPALFQSLLYEAVGRTVNPVNGAVGLLW 84
               999*****************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.752385IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-142684IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MAAEFSEKVA VIIVCLENVY SGXETPQAQA HATLFVAKFF GRAGLMSFIS AVPQHHRPAL  60
FQSLLYEAVG RTVNPVNGAV GLLWX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006339815.11e-32PREDICTED: LOB domain-containing protein 37
RefseqXP_004231911.11e-32PREDICTED: LOB domain-containing protein 37
RefseqXP_016560963.12e-32PREDICTED: LOB domain-containing protein 37
RefseqXP_011088059.12e-32PREDICTED: LOB domain-containing protein 37-like
SwissprotQ9SN232e-32LBD38_ARATH; LOB domain-containing protein 38
TrEMBLK4BD512e-32K4BD51_SOLLC; Uncharacterized protein
TrEMBLM1CBV81e-32M1CBV8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000641854e-32(Solanum tuberosum)
STRINGSolyc02g092550.2.14e-32(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72134136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49940.11e-33LOB domain-containing protein 38