PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK15337.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 323aa    MW: 35708.8 Da    PI: 8.0694
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK15337.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.63.6e-403293263
     zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
               +e+alkcprCdstntkfCyynnysl+qPryfCkaCrryWtkGG+lrnvPvGgg+r+nk+sss
  PK15337.1 32 PEQALKCPRCDSTNTKFCYYNNYSLTQPRYFCKACRRYWTKGGTLRNVPVGGGCRRNKRSSS 93
               6899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-293090IPR003851Zinc finger, Dof-type
PfamPF027011.5E-333490IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5163690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MSSSDSLGNM LVGSKQQSQH QDQRKQTSKP HPEQALKCPR CDSTNTKFCY YNNYSLTQPR  60
YFCKACRRYW TKGGTLRNVP VGGGCRRNKR SSSNNNNSSS SSTATSSATS SSKLIKPSHH  120
HNSLLLLPQQ LSVIGGSNSS SGYDSNDLSL AFARLQKQSS CGQLLGNFDH GYDHNHNNNE  180
LIGINNSNIG FLDALRNGFL DQSSHSNNNN NMFYGFGNGN EINGNVVVGN DDQNLGNHHH  240
HMSYNDHDHD DMMIKQELRS SSSSDHNNNK VLWGCPWQLN GSSSENNNQF HGGMAEIDHT  300
AGRESWNGLS SSWHGLLNTT PLM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104144.24e-89dof zinc finger protein DOF2.1
TrEMBLA0A2P5CMS31e-103A0A2P5CMS3_PARAD; Zinc finger transcription factor
STRINGXP_010104144.14e-84(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50263051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.17e-37TARGET OF MONOPTEROS 6