PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK14408.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRF
Protein Properties Length: 464aa    MW: 50415.5 Da    PI: 7.0538
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK14408.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.71.1e-2470113144
        WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                daepgrC+RtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  PK14408.1  70 DAEPGRCKRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKHVE 113
                79****************************************98 PP

2QLQ49.21.6e-17841235
        QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqai 35
               +FT+aQl +L++Q++++Ky++a++PvP +Ll++ 
  PK14408.1  8 PFTNAQLRELERQAMIFKYMVASVPVPLDLLLPF 41
               8*****************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.5E-8743IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.0E-11840IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.442843IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.12670114IPR014977WRC domain
PfamPF088792.6E-2071113IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MAASVGFPFT NAQLRELERQ AMIFKYMVAS VPVPLDLLLP FNRTMSGSAI PIHYPFGGSE  60
YKLRFSNGTD AEPGRCKRTD GKKWRCSRDV APDQKYCERH MHRGRPRSRK HVEVQLNNNN  120
NNNNNNNNSK RTRLDNNQQQ QQQQQQHTLS VSSSASLATS TTNSSITNHP QCHQNHFLGS  180
STTALPYHPS PVFIDKPAFE SMPSDKEARS MEWMMKGEDV TMAASDPRWL HLMQSSSKSS  240
FCDNNNSSSI FNQHGEEEPF LNLNSYGSFG TGGEVEQERE CAMFLNPEDV SLDNNNNNHH  300
QQQTNSETPR SFIDAWSKTN MTHSSCSSVN QSSITSQGRL SPSSLTLSMG GYGSINDEMG  360
TKPHVSNWLT PDSSWAPAGS PPGGPLAEVL RSSSLTATTT TTSAASDPSS PFAVGNGDSG  420
SPPATAVSSP SGVLQKTVTS LSDSSGCSSP GLGISKVKAE IALL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015871945.11e-140PREDICTED: growth-regulating factor 8-like
RefseqXP_015870685.11e-140PREDICTED: growth-regulating factor 8-like
RefseqXP_015870521.11e-140PREDICTED: growth-regulating factor 8-like
RefseqXP_015870430.11e-140PREDICTED: growth-regulating factor 8-like
TrEMBLM5XKV01e-135M5XKV0_PRUPE; Uncharacterized protein
STRINGVIT_16s0098g01080.t011e-119(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.17e-37growth-regulating factor 7