PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK14080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 336aa    MW: 36480.8 Da    PI: 7.069
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK14080.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.4e-393797262
     zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
               +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s+
  PK14080.1 37 QQQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRSK 97
               6899*****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-283695IPR003851Zinc finger, Dof-type
PfamPF027013.4E-333995IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6744195IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104379IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MQDVHSIGDG GRFHAGSGGG TGAASDRRLR PQHNQTQQQA LKCPRCDSLN TKFCYYNNYN  60
LSQPRHFCKN CRRYWTKGGV LRNVPVGGGC RKTKRSKQKT SSVSVTVTTA PVLPPPSQDR  120
KSNSHSSSES SSLTATNTNA ATEAVSAPST SSGSNLLSVN QESKFFVSQS TNASFEVSAL  180
IDQSVSDCGI FSDIGSFTNL ITSSSTGGGA LEAFEYTSIC DISISPFRLN QQNQDHHHHQ  240
VSQSQTWQQQ NTKTNVAPPD HDQLKMQEIT GGLLDQTSQA DLSVLQDRSN GGVFGSLGDW  300
QSCGDQGIFD LPNTVDQTYW GQSQWTDQDH TSVYLP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010101639.11e-134dof zinc finger protein DOF5.4
TrEMBLA0A2P5BC991e-135A0A2P5BC99_PARAD; Zinc finger, Dof-type
STRINGXP_010101639.11e-133(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.13e-40OBF binding protein 4