PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK13689.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 203aa    MW: 23653.8 Da    PI: 9.6722
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK13689.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.62.1e-162976148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEde l + +++ G g+W+t +++ g+ R++k+c++rw +yl
        PK13689.1 29 RGPWTAEEDEVLCEFIRKEGEGRWRTLPKRAGLLRCGKSCRLRWMNYL 76
                     89******************************99************97 PP

2Myb_DNA-binding48.22.6e-1586127548
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
        PK13689.1  86 QPDEEDLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 127
                      689***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-212078IPR009057Homeodomain-like
PROSITE profilePS5129416.6762476IPR017930Myb domain
SuperFamilySSF466898.07E-2926123IPR009057Homeodomain-like
SMARTSM007173.1E-122878IPR001005SANT/Myb domain
PfamPF002493.5E-142976IPR001005SANT/Myb domain
CDDcd001673.59E-93176No hitNo description
PROSITE profilePS5129424.18177131IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2479132IPR009057Homeodomain-like
SMARTSM007171.8E-1381129IPR001005SANT/Myb domain
PfamPF002494.2E-1486127IPR001005SANT/Myb domain
CDDcd001672.46E-1087127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
HWGFGNRWWL GDGGGSKTTP CCSKVGIKRG PWTAEEDEVL CEFIRKEGEG RWRTLPKRAG  60
LLRCGKSCRL RWMNYLRPSV KRGHIQPDEE DLILRLHRLL GNRWSLIAGR IPGRTDNEIK  120
NYWNTHLSKK LINQGIDPRT HKPFNNNNNN NQTPPPLLHH PLHHQQHDHT NKIMIMNNNN  180
NNNIHQAPPI MLSTVPEEEQ EEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25291317108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012070432.16e-85PREDICTED: transcription repressor MYB5-like
SwissprotQ388506e-82MYB5_ARATH; Transcription repressor MYB5
TrEMBLA0A067KXJ97e-85A0A067KXJ9_JATCU; MYB family protein
TrEMBLS5FZE33e-84S5FZE3_MALDO; MYB transcription factor
STRINGPOPTR_0001s04240.14e-82(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38943064
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.18e-77myb domain protein 5