PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK13485.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 507aa    MW: 55168.7 Da    PI: 5.383
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK13485.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.92.6e-39141201262
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s 
  PK13485.1 141 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKKCQRYWTAGGTMRNVPVGAGRRKNKNSA 201
                7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-31138198IPR003851Zinc finger, Dof-type
PfamPF027015.8E-32143199IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.733145199IPR003851Zinc finger, Dof-type
PROSITE patternPS013610147183IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MSEPKDPAIK LFGKTIPVAE VPVTSGGSQG PSVSASATSM DDNMDQEPKP NSSSSEVITS  60
KDEDDRDTEK ATTNDDPTET KEEDGNQPMS PEEPRNSGAT SGSSENPTTP VDKESVTPKA  120
SKTEEEQSEG NNSQEKTLKK PDKILPCPRC NSMDTKFCYY NNYNVNQPRH FCKKCQRYWT  180
AGGTMRNVPV GAGRRKNKNS ASHYRHITVS EALQNGRTDV SSGIHSPHPS MKSNGTVLTF  240
GSDAPLCESM ASVLNLADKN LRNCTQNGFL KPEEVRTPVP FQSVEHGDNN VDGSSITTSN  300
SKDEACNNVS QEQVIQNPQG VPPQMPCFPG PPWPYPWNAA QWNPSVPMPA FCPPGYPMPF  360
YPAPAYWGCS VPGTWNIPWL PMPTSQNPAA PSSGPNSPNS PTLGKHSRDE NTVKSNSSEE  420
EQPKESNSER CLWIPKTLRI DDPGEAARSS IWATLGIKND KADSISGGGL FKAFQPKNDE  480
KNHRAENSVL QANPAALSRS LSFQERS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010088142.10.0cyclic dof factor 2
TrEMBLA0A2P5FF120.0A0A2P5FF12_TREOI; Zinc finger, Dof-type
STRINGXP_010088142.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.25e-97cycling DOF factor 2