PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK12774.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family HD-ZIP
Protein Properties Length: 357aa    MW: 39479.9 Da    PI: 8.403
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK12774.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.16e-18207261256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  PK12774.2 207 RKKLRLSKEQSAFLEESFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTK 261
                778899***********************************************98 PP

2HD-ZIP_I/II128.33.1e-41207297192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  +kk+rlskeq+++LEesF+e+++L+p++Kv+la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL+ke +eLr +lk
    PK12774.2 207 RKKLRLSKEQSAFLEESFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTDENRRLQKELQELR-ALK 297
                  69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-17191257IPR009057Homeodomain-like
SuperFamilySSF466893.25E-18198264IPR009057Homeodomain-like
PROSITE profilePS5007117.216203263IPR001356Homeobox domain
SMARTSM003894.5E-16205267IPR001356Homeobox domain
PfamPF000462.3E-15207261IPR001356Homeobox domain
CDDcd000868.65E-16207264No hitNo description
PROSITE patternPS000270238261IPR017970Homeobox, conserved site
SMARTSM003403.0E-26263306IPR003106Leucine zipper, homeobox-associated
PfamPF021837.6E-11263297IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MELALSLGET NPTPFSFLHK ATQKITNNNN NNQSELGFCM ALGNSAFSSR SSSSSDQDQD  60
KKNIHDPSKQ VSSSSDLQLP LQLDLLPSAP VPRSQSTSSQ LRFPWLNDNL ISEPVGSKGF  120
DVNRLPGVGS TQPEETEDGV TISSPNSTLS SFHMDFCVRS SSSGGGLIRT NSNNKREYHS  180
NNNNIIECET ERASSRASDD EENGSTRKKL RLSKEQSAFL EESFKEHSTL NPKQKVALAK  240
QLNLRPRQVE VWFQNRRART KLKQTEVDCE YLKRCCETLT DENRRLQKEL QELRALKTSQ  300
PFYMQLPATT LTMCPSCERV ATSGAVTVAG TAANSGKPTQ HRFPHGQVGK AAPGNLQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1205211TRKKLRL
2255263RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010111372.11e-146homeobox-leucine zipper protein HOX11
SwissprotP466652e-98HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A2P5B6T21e-156A0A2P5B6T2_PARAD; Octamer-binding transcription factor
STRINGXP_010111372.11e-146(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-90homeobox from Arabidopsis thaliana