PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK12011.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 499aa    MW: 55154.1 Da    PI: 5.3733
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK12011.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.31.8e-184086148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
        PK12011.2 40 KGQWTPEEDETLRRAVQRFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 86
                     799****************************9.************986 PP

2Myb_DNA-binding64.61.9e-2092138148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd+ +v++vkq+G++ W+tIa++++ gR +kqc++rw+++l
        PK12011.2  92 KGPWSKEEDDVIVELVKQYGPKKWSTIANHLP-GRIGKQCRERWHNHL 138
                      79******************************.*************97 PP

3Myb_DNA-binding49.88e-16144186145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++a++ +G++ W+   + ++ gRt++++k++w+
        PK12011.2 144 KEAWTQEEELALIRAHQVYGNK-WAELTKFLP-GRTDNSIKNHWN 186
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.6033586IPR017930Myb domain
SuperFamilySSF466898.61E-1938100IPR009057Homeodomain-like
SMARTSM007173.9E-153988IPR001005SANT/Myb domain
PfamPF002491.9E-164086IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2342102IPR009057Homeodomain-like
CDDcd001672.91E-144386No hitNo description
PROSITE profilePS5129432.70287142IPR017930Myb domain
SuperFamilySSF466891.24E-3189185IPR009057Homeodomain-like
SMARTSM007172.3E-1891140IPR001005SANT/Myb domain
PfamPF002493.4E-1892138IPR001005SANT/Myb domain
CDDcd001671.96E-1694138No hitNo description
Gene3DG3DSA:1.10.10.602.1E-27103145IPR009057Homeodomain-like
PROSITE profilePS5129419.557143193IPR017930Myb domain
SMARTSM007178.2E-15143191IPR001005SANT/Myb domain
PfamPF002495.4E-14144187IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-22146193IPR009057Homeodomain-like
CDDcd001677.55E-12146186No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 499 aa     Download sequence    Send to blast
MKSLTLSMDN DRRISGLGDN IQKNRALNGR TSGPTRRSTK GQWTPEEDET LRRAVQRFKG  60
KNWKKIAECF KDRTDVQCLH RWQKVLNPEL VKGPWSKEED DVIVELVKQY GPKKWSTIAN  120
HLPGRIGKQC RERWHNHLNP AINKEAWTQE EELALIRAHQ VYGNKWAELT KFLPGRTDNS  180
IKNHWNSSVK KKLDSYLKSG LLTQFQGLPQ VGQQSQPIGS SSLKISGDDS SCRGTEAEEV  240
SECSQDSTVA GRFQTAGEMA NVVLNTREEL QTTEVTGSGN LPISSPASCS EPYYPSLEDS  300
AFSRAEISHD IDCGAKYLRQ NFSNDAEVSM GGDYHFDLHD MSNISSRHLE RESSEMQTYC  360
LGASESNEVA NVSLEISGGL IVSASMGNMH TGSEKPEHML ISDDECCRVL FSEAMNDECF  420
SSRNLEGGGS GSVLHQSSKI QMSDAGGSVP SQVPGHSSAD VTGISCSQNF FSDPVSVDDG  480
RLVFGSDSNS LLIVPEQEY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C5e-70401936159MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-70401936159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010100271.10.0Myb-related protein 3R-1
SwissprotQ9S7G71e-142MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLW9RKD70.0W9RKD7_9R
STRINGPOPTR_0006s25840.10.0(Populus trichocarpa)
STRINGGLYMA06G08660.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37273362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-137Homeodomain-like protein