PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK11664.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 576aa    MW: 63225.9 Da    PI: 8.1087
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK11664.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding482.8e-1559105148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT++Ede l  av+ + g++Wk+Ia+ ++  R++ qc +rwqk+l
        PK11664.1  59 KGGWTPQEDETLRSAVAAFNGKSWKKIAEFFN-DRSEVQCLHRWQKVL 105
                      688*****************************.************986 PP

2Myb_DNA-binding605.3e-19111157148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd+++ ++v ++G   W++Ia+ ++ gR +kqc++rw+++l
        PK11664.1 111 KGPWTPEEDKKITELVSKYGATKWSLIAKSLP-GRIGKQCRERWHNHL 157
                      79******************************.*************97 PP

3Myb_DNA-binding47.73.5e-15163206146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT  E++ l +a++ +G++ W+ Ia+ ++ gRt++ +k++w++
        PK11664.1 163 KDAWTIAEELSLMHAHQIHGNK-WAEIAKVLP-GRTDNAIKNHWNS 206
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.94754105IPR017930Myb domain
SMARTSM007175.5E-1358107IPR001005SANT/Myb domain
PfamPF002493.2E-1459105IPR001005SANT/Myb domain
SuperFamilySSF466899.33E-1560115IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-1761113IPR009057Homeodomain-like
CDDcd001674.47E-1162105No hitNo description
PROSITE profilePS5129431.716106161IPR017930Myb domain
SuperFamilySSF466891.49E-31108204IPR009057Homeodomain-like
SMARTSM007178.5E-18110159IPR001005SANT/Myb domain
PfamPF002492.7E-18111157IPR001005SANT/Myb domain
CDDcd001671.06E-15113157No hitNo description
Gene3DG3DSA:1.10.10.601.1E-26114164IPR009057Homeodomain-like
PROSITE profilePS5129420.534162212IPR017930Myb domain
SMARTSM007171.6E-12162210IPR001005SANT/Myb domain
PfamPF002499.6E-14163206IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-21165212IPR009057Homeodomain-like
CDDcd001671.16E-9165208No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MADVKLEECC LENKQSTAAS SSSVSEGSGS VIRKSPGVCS PASNSPSQWR TSGPVRRAKG  60
GWTPQEDETL RSAVAAFNGK SWKKIAEFFN DRSEVQCLHR WQKVLNPDLV KGPWTPEEDK  120
KITELVSKYG ATKWSLIAKS LPGRIGKQCR ERWHNHLNPE IRKDAWTIAE ELSLMHAHQI  180
HGNKWAEIAK VLPGRTDNAI KNHWNSSLKK KLDFFINTGS LPPVSKSNYQ NGPKDMSKCP  240
STKKTPVCSN KELDSTAHVL GSAAMYVINE DVNNQLDSSG ALCSMLGSSS APPNESADSE  300
GTESKPVSSN MDPSCSNSDS VMKFESGGIN REANIENWLI SKQSQHCSLN NEGKFDNCGF  360
DEEVKEDKVV GTPSSSGSLF FGSLCYEPPQ LDACIPLDSD LSSIHSLQNE FNSSTYSSPG  420
SCFTPPCVKG QSFNLQSPES VLKMAALTFP NTPSILRKRK YKEQTPLLPN KNKKADRESN  480
GDMLLDTQEH DVTKTNLEMP GSRDGSSCKS STYHGINSVC PNGKAFNASP PYRLRSKRTA  540
VLKSVEKHLD FTFEKEGHEG NVKTVEFSAK TKMGVT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-64582125159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-64582125159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010111464.10.0Myb-related protein 3R-1
TrEMBLW9SWG80.0W9SWG8_9R
STRINGVIT_08s0007g00360.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66163449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-135myb domain protein 3r-5