PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK11564.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family LBD
Protein Properties Length: 158aa    MW: 17556.2 Da    PI: 8.2299
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK11564.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260147.24.4e-46251241100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l++lpee+r+da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+++la +++e
  PK11564.1  25 PCAACKLLRRRCAQDCVFAPYFPADEPHKFASVHKVFGASNVNKMLQELPEEQRSDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDALQTQLAIAQAE 124
                7**********************************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.44624125IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4525122IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
XYNIMKENSN IGSTGNGRKQ GGMSPCAACK LLRRRCAQDC VFAPYFPADE PHKFASVHKV  60
FGASNVNKML QELPEEQRSD AVSSMVYEAN ARVRDPVYGC VGAISSLQQQ IDALQTQLAI  120
AQAEVVHMRM TQFSPTSNHN HHHNNNNYNN NNNNNSNN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004294159.19e-83PREDICTED: LOB domain-containing protein 4
SwissprotQ9SHE97e-65LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A0S3SK414e-83A0A0S3SK41_PHAAN; Uncharacterized protein
STRINGVIT_19s0027g01120.t011e-79(Vitis vinifera)
STRINGGLYMA08G17990.11e-79(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.11e-65LOB domain-containing protein 4