PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK11227.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family LBD
Protein Properties Length: 180aa    MW: 20563.3 Da    PI: 5.0077
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK11227.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.21.8e-40181171100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaC++lrr+C ++Cvl+pyfp e+ ++fa vhk+FGasn++k+++ ++e++r+da++s+vyeA ar+rdPvyG++g+il+lq+ +++l+++l+++ ++
  PK11227.1  18 PCAACRMLRRRCDRNCVLSPYFPPEEIENFAGVHKVFGASNIIKMIQMVEETNRDDAVKSIVYEATARVRDPVYGCAGIILHLQKMVSELNSQLETVTAQ 117
                7*********************************************************************************************998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.48217118IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-4018114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MESTDQVPNA RARLHHQPCA ACRMLRRRCD RNCVLSPYFP PEEIENFAGV HKVFGASNII  60
KMIQMVEETN RDDAVKSIVY EATARVRDPV YGCAGIILHL QKMVSELNSQ LETVTAQVME  120
IQIQRDKLLS LFMNINVDDH HYLEFDDTNS NSTAITTTQW SLDPLFDGCT TSIYDNSFQF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010100715.11e-65hypothetical protein L484_023484
SwissprotQ9LQR04e-49LBD1_ARATH; LOB domain-containing protein 1
TrEMBLW9RLJ31e-65W9RLJ3_9R
STRINGVIT_15s0046g00240.t017e-61(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF140681921
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-50LOB domain-containing protein 1