PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK10955.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 413aa    MW: 44187 Da    PI: 9.4258
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK10955.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.82.8e-39117175361
     zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                 ++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk++
  PK10955.1 117 PESLRCPRCDSANTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKTT 175
                57899***************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.1E-32119174IPR003851Zinc finger, Dof-type
ProDomPD0074789.0E-24119170IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.432120174IPR003851Zinc finger, Dof-type
PROSITE patternPS013610122158IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
XDCCRSRLKD ISKSPQKMIQ ELLGGGGGGG SGHHNLHHHH QHNHHHHLLG TPTHGDNQNR  60
KISSIINGGG LLEATTTTTT TTLLHNNSST VPITTPTTTT TPPTTTTSSG AGATATPESL  120
RCPRCDSANT KFCYYNNYNL TQPRHFCKTC RRYWTKGGAL RNVPIGGGCR KNKTTIVSSS  180
VVSGKSAASG GGGVANSTGK MKMVMSSSEI NNIGRSGFGG GGLFDLHDHH QLSSNSPILW  240
GSPQNSHLLA LLRSTTTSPQ NPNPNPSSPQ NNNNINNNSS ESVVVKQQGG LDPVSQAPSL  300
GLCSSFWRNN QVNNNQSQNP HYQQINGLIS SASLPHHNNN DNNNNGIQEM YQRLRSSSST  360
TTSSSPANNN NNYYNDHHSS VGGPGDHQMG FWNINPPPFS WPDLSTTTNG AYP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024924337.11e-80dof zinc finger protein DOF1.1-like
RefseqXP_024932646.11e-80dof zinc finger protein DOF1.1-like
TrEMBLA0A2P5ADJ93e-94A0A2P5ADJ9_PARAD; Zinc finger, Dof-type
STRINGPOPTR_0007s11620.13e-75(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72193247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28810.26e-31Dof family protein