PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK10827.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 447aa    MW: 49819.3 Da    PI: 6.1407
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK10827.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.99.4e-3875136263
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                ++k+l+cprC+s  tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvPvG+grr+nk+sss
  PK10827.2  75 PDKILPCPRCNSLGTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTIRNVPVGAGRRRNKHSSS 136
                68999*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-2963132IPR003851Zinc finger, Dof-type
PfamPF027011.2E-3077133IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.41679133IPR003851Zinc finger, Dof-type
PROSITE patternPS01361081117IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MSSXNFQDEC REEATKAEVE DTGERCCEHD SFSDSEGKGN SYQNHVQENE VNCNPVEYQR  60
SESDRSSKEK ILKRPDKILP CPRCNSLGTK FCYFNNYNVN QPRHFCKNCQ RYWTAGGTIR  120
NVPVGAGRRR NKHSSSQLHQ ETTNDSAAVV TQEDINNATS DQSPPSNRFP ASARLDNGMA  180
EGLKFSSETP LCESMETKLN IEDHKKSEIE SAAFGDSSED LSLSSNSLNA HSSQNSSCFR  240
REDDSADHRH PMQCYPVPQW AYPWNPGWSV MMVGQNDSNP NPSNVGTLPM VSIPGFSAPN  300
TPFPFLPASY WGYMPNWDTQ NWTQPINRYS GNMPPSSSTV NTNSSSNSSA ILGKHSRDTN  360
MQAEEKTGQR LWVPKTLRID DPDKAAKSSI WSTLGIKPDK NTPIIRGGIF KAFQPKSDAN  420
SRSLDADQVL QSNPAALSRS HSFEEST
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024024457.11e-174cyclic dof factor 2
TrEMBLA0A2P5CDN60.0A0A2P5CDN6_TREOI; Zinc finger, Dof-type
STRINGXP_010086689.11e-169(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35023165
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-63cycling DOF factor 2