PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK10827.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 486aa    MW: 53915.8 Da    PI: 5.7852
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK10827.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.71.1e-37114175263
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                ++k+l+cprC+s  tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvPvG+grr+nk+sss
  PK10827.1 114 PDKILPCPRCNSLGTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTIRNVPVGAGRRRNKHSSS 175
                68999*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-29102171IPR003851Zinc finger, Dof-type
PfamPF027011.3E-30116172IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.416118172IPR003851Zinc finger, Dof-type
PROSITE patternPS013610120156IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
XMSLSQSQLT DPAIKLFGTN IPLPPSNSSS ETSHSDDSPL SQSQFMDECR EEATKAEVED  60
TGERCCEHDS FSDSEGKGNS YQNHVQENEV NCNPVEYQRS ESDRSSKEKI LKRPDKILPC  120
PRCNSLGTKF CYFNNYNVNQ PRHFCKNCQR YWTAGGTIRN VPVGAGRRRN KHSSSQLHQE  180
TTNDSAAVVT QEDINNATSD QSPPSNRFPA SARLDNGMAE GLKFSSETPL CESMETKLNI  240
EDHKKSEIES AAFGDSSEDL SLSSNSLNAH SSQNSSCFRR EDDSADHRHP MQCYPVPQWA  300
YPWNPGWSVM MVGQNDSNPN PSNVGTLPMV SIPGFSAPNT PFPFLPASYW GYMPNWDTQN  360
WTQPINRYSG NMPPSSSTVN TNSSSNSSAI LGKHSRDTNM QAEEKTGQRL WVPKTLRIDD  420
PDKAAKSSIW STLGIKPDKN TPIIRGGIFK AFQPKSDANS RSLDADQVLQ SNPAALSRSH  480
SFEEST
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024024457.10.0cyclic dof factor 2
TrEMBLA0A2P5CDN60.0A0A2P5CDN6_TREOI; Zinc finger, Dof-type
STRINGXP_010086689.11e-168(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35023165
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.27e-62cycling DOF factor 2