PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK10500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 477aa    MW: 51821.1 Da    PI: 6.1914
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK10500.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.39.7e-40128188262
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                ++k+l+cprC+s++tkfCyynny+++qPr+fCkaC+ryWt+GG++rnvPvG+grrknk+s 
  PK10500.1 128 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKACQRYWTAGGTMRNVPVGAGRRKNKNSA 188
                7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-31121185IPR003851Zinc finger, Dof-type
PfamPF027012.6E-32130186IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.863132186IPR003851Zinc finger, Dof-type
PROSITE patternPS013610134170IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MLESKDPAIT LFGMKIPLPC ENEAPAVSGD DFASQPSERE VDNDDDEEPE KDSSARSVSD  60
EDSEQEGDLC PQTDYSRNLD SIPGSSSVNP KTPSINEESS KSKLQMTDKE HGDATNTNNS  120
QEKTLKKPDK ILPCPRCNSM DTKFCYYNNY NVNQPRHFCK ACQRYWTAGG TMRNVPVGAG  180
RRKNKNSASH YRHISISEAL HAARIDASSN GSHHTGLKTN GRVLSFGIDS PICDSMASVL  240
NLADKKVLSG NRNGYYKTEG KENNGDDCSS VSSVTISNTT DETGKNCPQE PQMHNINGQR  300
FPSVPCLPGV PWPYPWNSGV PPPAFCPPGF PMSFYPGAYW NCPVPGTWNV PWFPPQPSSP  360
NQKSPSPGSG SNSPTLGKHS RDGDTLNSDS CENEEPPKQK NGSVLVPKTL RIDDPSEAAK  420
SSIWATLGIK NDSISGGGMF KAFQSKTNDK KGIAETSPVL RANPAALSRS LNFHENS
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. {ECO:0000250, ECO:0000269|PubMed:19619493}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00394DAPTransfer from AT3G47500Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Highly expressed at the beginning of the light period, then decreases, reaching a minimum between 16 and 29 hours after dawn before rising again at the end of the day. {ECO:0000269|PubMed:19619493}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010089911.10.0cyclic dof factor 3
SwissprotQ8LFV31e-125CDF3_ARATH; Cyclic dof factor 3
TrEMBLA0A2P5AJN00.0A0A2P5AJN0_PARAD; Zinc finger, Dof-type
STRINGXP_010089911.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.11e-116cycling DOF factor 3
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Corrales AR, et al.
    Multifaceted role of cycling DOF factor 3 (CDF3) in the regulation of flowering time and abiotic stress responses in Arabidopsis.
    Plant Cell Environ., 2017. 40(5): p. 748-764
    [PMID:28044345]
  4. Renau-Morata B, et al.
    Ectopic Expression of CDF3 Genes in Tomato Enhances Biomass Production and Yield under Salinity Stress Conditions.
    Front Plant Sci, 2017. 8: p. 660
    [PMID:28515731]
  5. Henriques R, et al.
    The antiphasic regulatory module comprising CDF5 and its antisense RNA FLORE links the circadian clock to photoperiodic flowering.
    New Phytol., 2017. 216(3): p. 854-867
    [PMID:28758689]