PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK10274.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 132aa    MW: 15664.5 Da    PI: 9.7976
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK10274.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-161057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W +eEde+l+  v+++G ++W++ a+  g++R++k+c++rw++yl
        PK10274.1 10 KGTWLEEEDERLISFVQLMGEKRWDALAKASGLRRSGKSCRLRWLNYL 57
                     799********************************************7 PP

2Myb_DNA-binding54.13.5e-1767108548
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++eE+ +++++++++G++ W++Iar ++ gRt++++k++w++yl
        PK10274.1  67 SAEEENIIIQLHERWGNK-WSKIARILP-GRTDNEIKNYWRTYL 108
                      89****************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.355557IPR017930Myb domain
SuperFamilySSF466897.99E-288104IPR009057Homeodomain-like
SMARTSM007176.3E-14959IPR001005SANT/Myb domain
PfamPF002494.8E-151057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-211164IPR009057Homeodomain-like
CDDcd001677.32E-91257No hitNo description
PROSITE profilePS5129425.77558112IPR017930Myb domain
SMARTSM007178.0E-1562110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-2465112IPR009057Homeodomain-like
PfamPF002491.3E-1567108IPR001005SANT/Myb domain
CDDcd001678.60E-1167108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MQGEHDQLRK GTWLEEEDER LISFVQLMGE KRWDALAKAS GLRRSGKSCR LRWLNYLRPN  60
LKHDQISAEE ENIIIQLHER WGNKWSKIAR ILPGRTDNEI KNYWRTYLRK KLAQNQEEKG  120
KEDIATTAIG DX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-3071121105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00406DAPTransfer from AT3G53200Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010098805.11e-67Myb-related protein MYBAS1
SwissprotQ53NK66e-50MYBA1_ORYSJ; Myb-related protein MYBAS1
TrEMBLW9R8B81e-67W9R8B8_9R
STRINGVIT_08s0007g04830.t011e-57(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF131692631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53200.16e-53myb domain protein 27