PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK10122.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GATA
Protein Properties Length: 110aa    MW: 12144 Da    PI: 11.0161
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK10122.6genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.42.2e-193064135
       GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
               Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l
  PK10122.6 30 CSHCGVQKTPQWRTGPLGAKTLCNACGVRFKSGRL 64
               *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577165.7E-152386No hitNo description
PROSITE profilePS5011411.8862460IPR000679Zinc finger, GATA-type
SMARTSM004011.1E-152478IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.1E-152862IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.50E-122977No hitNo description
PROSITE patternPS0034403055IPR000679Zinc finger, GATA-type
PfamPF003203.1E-173064IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
KKPKKKLTQV GHATNPANPT NPAGQPSRRC SHCGVQKTPQ WRTGPLGAKT LCNACGVRFK  60
SGRLLPEYRP ACSPTFSSEL HSNHHRKVLE MRRKKEDVPV AESGFVVPSF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001242253.11e-47uncharacterized protein LOC100783966
RefseqXP_004512096.11e-47PREDICTED: GATA transcription factor 5
SwissprotQ9FH578e-47GATA5_ARATH; GATA transcription factor 5
TrEMBLA0A0R0LC163e-48A0A0R0LC16_SOYBN; Uncharacterized protein
TrEMBLI1J8P11e-47I1J8P1_SOYBN; Uncharacterized protein
STRINGGLYMA01G37450.13e-47(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.25e-48GATA transcription factor 5