PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK10122.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GATA
Protein Properties Length: 348aa    MW: 37822.7 Da    PI: 4.699
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK10122.4genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.49.7e-19259292134
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                Cs+C++ kTp+WR gp g+ktLCnaCG+++++ +
  PK10122.4 259 CSHCQVQKTPQWRTGPLGPKTLCNACGVRFKSGR 292
                *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.0E-7821332IPR016679Transcription factor, GATA, plant
SMARTSM004014.0E-14253307IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.8E-14253315No hitNo description
PROSITE profilePS5011411.187253289IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.3E-14257290IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.33E-13258315No hitNo description
PROSITE patternPS003440259284IPR000679Zinc finger, GATA-type
PfamPF003201.9E-16259292IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MEGMEAKALR PSLRGELTQL EDFEEVYNNN NNGTGISCDD FSIDELLNLQ NGEFEEGSVE  60
EEEEEEEKDS LCVDEESLTL SGGSSGAGDS ESALTSELAV PDDDLAELEW VSHFVDDSFS  120
DFSLLHPIEK QSTEFHSENQ LEQPEPTRPG TNPTCFPSVP VKTRTKRARP TTQPWSRTNS  180
LSQLTESNST TSSSSSSSPP PCSASFSSNP CLIFNNNVVQ TMEFLRNLGE PPIKKPKKKP  240
AAVQAGAGAV VGPQFQRRCS HCQVQKTPQW RTGPLGPKTL CNACGVRFKS GRLFPEYRPA  300
CSPTFSSEVH SNSHRKVLEM RKKKEVVGSG SGPGPGSGSG LARVISSF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010109771.11e-114hypothetical protein L484_008447
TrEMBLW9S3D01e-114W9S3D0_9R
STRINGPOPTR_0009s12620.11e-93(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.25e-39GATA transcription factor 5