PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK10122.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GATA
Protein Properties Length: 340aa    MW: 37215.9 Da    PI: 4.7317
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK10122.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.11.2e-18256289134
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +
  PK10122.2 256 CSHCGVQKTPQWRTGPLGAKTLCNACGVRFKSGR 289
                *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.4E-761329IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.886250286IPR000679Zinc finger, GATA-type
SMARTSM004011.2E-14250304IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.57E-14252313No hitNo description
Gene3DG3DSA:3.30.50.101.8E-14254287IPR013088Zinc finger, NHR/GATA-type
CDDcd002028.58E-14255312No hitNo description
PROSITE patternPS003440256281IPR000679Zinc finger, GATA-type
PfamPF003201.8E-16256289IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MECVEGTFKT SFEENGDDFF VDDLLNFSNE DCFVEEDEPE QEPEEEEDNK GFDSVSPSLL  60
NPNQTEEQDN SIPVTSTSFS TKHQFGPVPN NNTTTELSVP VDELANLEWL SHFVEDSFSE  120
FSTPYLAGTG GVSSENPKNQ TEKIAPEPQM VTIPEKPCFS TPVPAKARSK RTRTGGRVWS  180
MGSPSFTESS SSSTSSSSSS SPSSPWLLYQ TVLSHDPAGS VEKPQAKKPK KKLTQVGHAT  240
NPANPTNPAG QPSRRCSHCG VQKTPQWRTG PLGAKTLCNA CGVRFKSGRL FPEYRPACSP  300
TFSSEVHSNS HRKVLEMRKK KEVVDPDPDP DPGQDPGWPA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008241780.11e-104PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH575e-71GATA5_ARATH; GATA transcription factor 5
TrEMBLM5WGI31e-104M5WGI3_PRUPE; Uncharacterized protein
STRINGVIT_04s0023g02880.t013e-89(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.24e-68GATA transcription factor 5