PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK09808.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family LBD
Protein Properties Length: 62aa    MW: 6928.47 Da    PI: 4.1935
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK09808.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26064.92e-2025944101
     DUF260  44 kllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q+++l+ +lal+++e+
  PK09808.1   2 KMLQELPFDQRADAVSSLVYEANARMRDPVYGCVGAISYLQNQVSELQMQLALAQAEI 59 
                89***************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089112.158159IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-18256IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 62 aa     Download sequence    Send to blast
XKMLQELPFD QRADAVSSLV YEANARMRDP VYGCVGAISY LQNQVSELQM QLALAQAEIL  60
CX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008233810.12e-33PREDICTED: LOB domain-containing protein 12-like
RefseqXP_009604707.12e-33PREDICTED: LOB domain-containing protein 12-like isoform X2
RefseqXP_016435041.12e-33PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW31e-32LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A103YJ264e-34A0A103YJ26_CYNCS; Lateral organ boundaries domain-containing protein (Fragment)
STRINGGSMUA_Achr6P15660_0011e-32(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.18e-34LBD family protein