PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK09793.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRF
Protein Properties Length: 365aa    MW: 41427.9 Da    PI: 8.2379
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK09793.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.18.3e-2578121144
        WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                d+epgrCrRtDGKkWRCs+++ +++k+CErH+hrg++rsrk++e
  PK09793.1  78 DPEPGRCRRTDGKKWRCSKEAFPDSKYCERHMHRGKNRSRKPVE 121
                79***************************************987 PP

2QLQ57.34.7e-20842236
        QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
               +FTa+Q+q+L++Q+l++Ky++++ P+Pp+Ll+ ++
  PK09793.1  8 PFTASQWQELEHQALIFKYMVSGIPIPPDLLFTLK 42
               8*****************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.7E-11743IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.935843IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.5E-15840IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.15678122IPR014977WRC domain
PfamPF088796.4E-2179121IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MSGKTRFPFT ASQWQELEHQ ALIFKYMVSG IPIPPDLLFT LKRSYLDSTA VLPSKLFPHH  60
SQHVGWNCFQ MGLGRKIDPE PGRCRRTDGK KWRCSKEAFP DSKYCERHMH RGKNRSRKPV  120
EVLKTTGTNS NLSNPSTLVS SNKNLSNNSL SSLTSLPSES QNRHLHPYHN PHLDHQQQPF  180
SVYNHSSSSS SRPNGIGLSS QDSNTSLLFD SGSYSNADLR YVYGLKDDVD EHSFFSEEPS  240
RTHVRDLSMD ESWQLTPLTM SCSSSSSKQR SCSGLQSEHS YLQLQSSNHC DLRRNDVKME  300
RKEATQKTIH FIDEWPVKEK DSSWLELDDK SSNSGSVSTT QLSISIPTSS YDFPIFNTCR  360
THNGD
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0098462e-47AP009846.1 Lotus japonicus genomic DNA, clone: LjT02E24, TM1624a, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015889271.11e-142PREDICTED: growth-regulating factor 5-like isoform X5
TrEMBLA0A0B0P2H21e-132A0A0B0P2H2_G
TrEMBLA0A0D2TIQ41e-132A0A0D2TIQ4_G
STRINGPOPTR_0018s07140.11e-127(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40433459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.14e-56growth-regulating factor 5