PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK09499.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family G2-like
Protein Properties Length: 190aa    MW: 21778.3 Da    PI: 11.0645
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK09499.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.51.3e-32125178255
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                pr+rWt+ LH+rFv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  PK09499.1 125 PRMRWTTSLHSRFVHAVQLLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 178
                9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.73E-16122179IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.8E-29123179IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-24125178IPR006447Myb domain, plants
PfamPF002496.6E-8126177IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
XPWIRRIDNF PSRSERKQSS SSSSPTRFSS DNHQMKTKTI KGIPIYNNNN TPSDQLRLRS  60
DGAVCFGGGY SKLYYSHQQI PPYPNLLPIS LPSSRVYNPS MENRVHHHHN HNQFGNNSKR  120
NMRAPRMRWT TSLHSRFVHA VQLLGGHERA TPKSVLELMD VKDLTLAHVK SHLQMYRTVK  180
NTDKPMASSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-17126180458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-17126180458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-17126180357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-17126180357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-17126180357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-17126180357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-17126180458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-17126180458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-17126180458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-17126180458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-17126180458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-17126180458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012088450.16e-45transcription repressor KAN1 isoform X1
SwissprotQ9C6169e-40KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A2P5E1596e-45A0A2P5E159_PARAD; KANADI transcription factor
STRINGcassava4.1_008805m4e-43(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-40G2-like family protein
Publications ? help Back to Top
  1. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]