PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK09358.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 311aa    MW: 34089.9 Da    PI: 7.0173
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK09358.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.47.4e-3965121460
     zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                + +kcprC+st+tkfCyynnysl+qPryfCk+CrryWtkGG+lrn+PvGgg+rknkk
  PK09358.2  65 ALVKCPRCESTHTKFCYYNNYSLTQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKK 121
                6789***************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-2657117IPR003851Zinc finger, Dof-type
PfamPF027019.3E-3366121IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.79867121IPR003851Zinc finger, Dof-type
PROSITE patternPS01361069105IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MGFTSVQVCM DLSSDWLQGT IHEDSSGIDS SSPSNDNILT YSKPTIMEQQ QQQQQQRLRP  60
PNDNALVKCP RCESTHTKFC YYNNYSLTQP RYFCKTCRRY WTKGGTLRNI PVGGGCRKNK  120
KPAPKKTNDN NSAVVLINTK NNHNNGGGDD IGGSTSTTDL KLSFPDQVQF SHLSNLLGTH  180
GPGPNSFFES PRPIDFGMVG IGLGNISNSS SHHHGIIEPN NFHGLCSPFG MSLDGTGTGT  240
FMDTCQRIMM SYEGNDDDQK YGIDVKPNAK LLALDWQDHG GCTDAGKDSF GYLNSLGLMN  300
NYGPPTMNPL V
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Promotes expression (PubMed:19915089). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Involved in the regulation of interfascicular cambium formation and vascular tissue development, particularly at a very early stage during inflorescence stem development; promotes both cambium activity and phloem specification, but prevents xylem specification (PubMed:19915089). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:19915089, ECO:0000269|PubMed:30626969}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021292203.11e-117dof zinc finger protein DOF5.6
SwissprotQ9FM035e-41DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLA0A2P5AF621e-117A0A2P5AF62_PARAD; Zinc finger, Dof-type
STRINGXP_010101217.11e-115(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50923456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.18e-37Dof family protein
Publications ? help Back to Top
  1. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]