PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK09358.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 357aa    MW: 38638.9 Da    PI: 7.9323
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK09358.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.19.2e-39111167460
     zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                + +kcprC+st+tkfCyynnysl+qPryfCk+CrryWtkGG+lrn+PvGgg+rknkk
  PK09358.1 111 ALVKCPRCESTHTKFCYYNNYSLTQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKK 167
                6789***************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.2E-32112167IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-25113167IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.798113167IPR003851Zinc finger, Dof-type
PROSITE patternPS013610115151IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
XVICLATAFS SHLLIFFIII IIIFLFFFTI DNVGGDATTD LTGNPATNYT INSTTTTAHV  60
GSSRPSSGAG GGGSNSSGSS TEDLALNRRR LLAEQQQQQQ QQRLRPPNDN ALVKCPRCES  120
THTKFCYYNN YSLTQPRYFC KTCRRYWTKG GTLRNIPVGG GCRKNKKPAP KKTNDNNSAV  180
VLINTKNNHN NGGGDDIGGS TSTTDLKLSF PDQVQFSHLS NLLGTHGPGP NSFFESPRPI  240
DFGMVGIGLG NISNSSSHHH GIIEPNNFHG LCSPFGMSLD GTGTGTFMDT CQRIMMSYEG  300
NDDDQKYGID VKPNAKLLAL DWQDHGGCTD AGKDSFGYLN SLGLMNNYGP PTMNPLV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021292203.13e-99dof zinc finger protein DOF5.6
TrEMBLA0A2P5AF621e-113A0A2P5AF62_PARAD; Zinc finger, Dof-type
STRINGEOY207325e-96(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50923456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.11e-32TARGET OF MONOPTEROS 6