PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK09202.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family ARR-B
Protein Properties Length: 618aa    MW: 67890.7 Da    PI: 6.0656
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK09202.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.31.4e-27209262155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                kpr++W+peLH++F  av++L G+ekA+Pk+il++m+ +gLt+e+v+SHLQkYRl
  PK09202.1 209 KPRVVWSPELHKKFCAAVHKL-GPEKAVPKKILDMMNEEGLTRENVASHLQKYRL 262
                79*******************.********************************8 PP

2Response_reg79.21.4e-26231311109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ +++l+++l+k +y +v+++ ++ +al++l++++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ +++ +++ + +  Ga 
     PK09202.1  23 VLAVDDNPTCLRILESLLRKCQY-QVTTTNQAIKALKMLRKNRnrFDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSEYSDTKLVMKGITHGAV 117
                   799********************.***************998889*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +ee+ +
     PK09202.1 118 DYLLKPVRMEEVKN 131
                   ********999865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.3E-1541617IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.9E-4120144No hitNo description
SuperFamilySSF521726.4E-3520142IPR011006CheY-like superfamily
SMARTSM004482.9E-3121133IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.77122137IPR001789Signal transduction response regulator, receiver domain
PfamPF000728.7E-2423131IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.66E-2724137No hitNo description
Gene3DG3DSA:3.40.50.23001.9E-41180185No hitNo description
SuperFamilySSF466891.97E-18206266IPR009057Homeodomain-like
PROSITE profilePS5129411.889206265IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.4E-28207266IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-23209262IPR006447Myb domain, plants
PfamPF002498.2E-10211261IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 618 aa     Download sequence    Send to blast
MTVEDQRGED GGSFDRFPVG MRVLAVDDNP TCLRILESLL RKCQYQVTTT NQAIKALKML  60
RKNRNRFDLV ISDVNMPDMD GFKLLELVGL EMDLPVIMLS EYSDTKLVMK GITHGAVDYL  120
LKPVRMEEVK NIWQHVIRRK KLDPCDQGKH SDQGKTCHES GEGGKGVTSI GLNQNATTNR  180
KRKDQDEDEE DEGEYDEHES EDPSSTQKKP RVVWSPELHK KFCAAVHKLG PEKAVPKKIL  240
DMMNEEGLTR ENVASHLQKY RLYLKRLPGA NQQARLVAAL RAKGCSYVCM DTLDGFGDMH  300
TMNGSGRLAS SALSSSYTHG GMLGRLNSPS GLTIGGISSN GLIQPGNPQN LSSSFSTLGK  360
FQPSISVNQS ASLFQGIPTL EHNKLQQTKS TAHIGEFNPL NSSSGFAVPA SFPDMRVTPS  420
SSSTARSSSS NPLMGDQSSV RVTPLLPESF DGESRGSSDF LDHNHYNESW EVAVQSSNFS  480
SITLLRECSS HGQIHSNNLG IPSTTAQISN SPHDFSSSNA FLEPLAGPRD GHGHGNFIGN  540
AVQSADYTEK HRWDNHNLNQ DFGTLNSIVD QLNGCTSSAF ESNEIENSAM VAKTETNEDF  600
IENIESLDDI MSAMMKRG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-22205267163ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023908186.10.0two-component response regulator ARR12-like isoform X2
SwissprotA2X1N21e-123ORR24_ORYSI; Two-component response regulator ORR24
SwissprotQ6H8051e-123ORR24_ORYSJ; Two-component response regulator ORR24
TrEMBLA0A2P5ETE60.0A0A2P5ETE6_TREOI; Two-component response regulator
STRINGXP_008242944.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-110response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]