PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK08857.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 338aa    MW: 37982 Da    PI: 5.2254
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK08857.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.3e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ +   G  +W+++++  g++R++k+c++rw +yl
        PK08857.1 14 KGPWTAEEDKKLINFILTNGHCCWRAVPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding538e-1770111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       T+ E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
        PK08857.1  70 LTEAEEQLVIDLHARLGNR-WSKIASRLP-GRTDNEIKNHWNTH 111
                      699****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-21563IPR009057Homeodomain-like
PROSITE profilePS5129413.91961IPR017930Myb domain
SuperFamilySSF466891.98E-2711108IPR009057Homeodomain-like
SMARTSM007171.1E-121363IPR001005SANT/Myb domain
PfamPF002491.2E-141461IPR001005SANT/Myb domain
CDDcd001677.76E-91661No hitNo description
PROSITE profilePS5129427.59762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.5E-2564116IPR009057Homeodomain-like
SMARTSM007171.7E-1566114IPR001005SANT/Myb domain
PfamPF002494.5E-1569111IPR001005SANT/Myb domain
CDDcd001672.03E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLINFIL TNGHCCWRAV PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL TEAEEQLVID LHARLGNRWS KIASRLPGRT DNEIKNHWNT HIKKKLLKMG  120
IDPVTHEPLI IINKDNDQLN KPSKTTIEPS QHDNNNKKNP NNNTTTTTTT HHSQESSGST  180
ATTEVENSSA SSPAAAENST TSSGDEESLW LLADHNNNNN SLSNDESFMN DLWINDNNIK  240
SPPELVDHDD YTNSLMLWNN NNSINSSDDH LSCPPPPPSS CINGDILPSF EDTYCSSSWL  300
MDCQDFGIQD FGLFDSSYFD DFELNKALNA IEMGDNLH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C6e-28141164105C-Myb DNA-Binding Domain
1mse_C6e-28141164105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010093656.11e-131Protein ODORANT1
TrEMBLW9QU231e-131W9QU23_9R
STRINGPOPTR_0001s07830.11e-103(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.11e-87myb domain protein 85