PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK08504.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family HD-ZIP
Protein Properties Length: 841aa    MW: 91400.2 Da    PI: 5.8755
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK08504.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.7e-21124179156
                TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  PK08504.1 124 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 179
                688999***********************************************999 PP

2START207.26.4e-653305551206
                HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECT CS
      START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetleviss 87 
                ela++a++elvk+a+ eep+W+ks     e +n++e++++f +  +     + +ea+r+sg+v+ ++  lve+l++++ +W e+++    + +t++viss
  PK08504.1 330 ELALAAMDELVKMAQTEEPLWMKSFeggrEVLNEEEYMRSFNPCIGmkpngFVTEASRESGIVIINSLALVETLMESS-RWAEMFPcviaRTSTTDVISS 428
                5899*********************9**9************9988899999***************************.********************* PP

                T......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHH CS
      START  88 g......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwvehvdlkgrlphw 179
                g      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  +++++  +s++ +++lpSg+++++++ g+skvtwveh++++++++h+
  PK08504.1 429 GmggtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDTIRDNSSgPPSFINCRRLPSGCVVQDMPSGYSKVTWVEHAEYDENQIHQ 528
                *********************************************************999**************************************** PP

                HHHHHHHHHHHHHHHHHHHHTXXXXXX CS
      START 180 llrslvksglaegaktwvatlqrqcek 206
                l+r+l++sg+ +ga++w atlqrqce+
  PK08504.1 529 LYRPLLSSGMGFGAQRWIATLQRQCEC 555
                *************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.03E-20106181IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.5E-22111181IPR009057Homeodomain-like
PROSITE profilePS5007117.216121181IPR001356Homeobox domain
SMARTSM003899.9E-18122185IPR001356Homeobox domain
CDDcd000861.38E-18123181No hitNo description
PfamPF000461.4E-18124179IPR001356Homeobox domain
PROSITE patternPS000270156179IPR017970Homeobox, conserved site
PROSITE profilePS5084843.961321558IPR002913START domain
SuperFamilySSF559613.94E-33323555No hitNo description
CDDcd088751.21E-122325554No hitNo description
SMARTSM002345.9E-49330555IPR002913START domain
PfamPF018521.7E-57330555IPR002913START domain
SuperFamilySSF559613.94E-23584754No hitNo description
SuperFamilySSF559613.94E-23794834No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 841 aa     Download sequence    Send to blast
MSFGGFLDNS TSTSGGGARL VAEIPYSSTS NNDNNHIMPS TAIAQPRLIT QSLTKSMFNS  60
PGLSLALQTN IDGQGDMIRN MAESFEPGSG RRSRDEEHES RSGSDNMDGG SGDDQDATDK  120
PPRKKRYHRH TPQQIQELEA LFKECPHPDE KQRLELSKRL CLETRQVKFW FQNRRTQMKT  180
QLERHENSLL RQENDKLRAE NMSIRDAMRN PMCTNCGGPA IIGEISLEEQ HLRIENARLK  240
DELERVCSLA GKFLGRPISA LATSMAPPLP SSALELGVGS NGFGGLTSVS TTMPDFGISS  300
NTLAALPPQS RSQGGVQVLD RSIERSMYLE LALAAMDELV KMAQTEEPLW MKSFEGGREV  360
LNEEEYMRSF NPCIGMKPNG FVTEASRESG IVIINSLALV ETLMESSRWA EMFPCVIART  420
STTDVISSGM GGTRNGALQL MHAELQVLSP LVPVREVNFL RFCKQHAEGV WAVVDVSIDT  480
IRDNSSGPPS FINCRRLPSG CVVQDMPSGY SKVTWVEHAE YDENQIHQLY RPLLSSGMGF  540
GAQRWIATLQ RQCECLAILM SSTVPTRDHT AGITSSGRRS MLKLAQRMTD NFCAGVCAST  600
VHKWNKLNAG NVDEDVRVMT RKSVDDPGEP PGIVLSAATS VWLPVSPQRL FDFLRDESLR  660
SEWDILSNGG PMQEMAHIAK GQNHGNCVSL LRASAMNTNQ SSMLILQETC IDEAGSLVVY  720
APVDIPAMHV VMNGGDSAYV ALLPSGFAIV PDGPGSRGPN LGSTPNGGCS NNNNNNGGSG  780
SNGNGGGDGS HRASGSLLTV AFQILVNSLP TAKLTVESVE TVNNLISCTV QKIKAALQCE  840
S
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024018220.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A2P5CNQ40.0A0A2P5CNQ4_TREOI; Octamer-binding transcription factor
STRINGXP_010091553.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]