PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK08229.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GeBP
Protein Properties Length: 370aa    MW: 41145.2 Da    PI: 4.5916
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK08229.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573111.55.5e-35170263398
     DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWgs 98 
                 qrlws++Dei +L+Glid+++k+gk+p++d++af +f+kk+++++v+k+ql++Ki rLKkK+  + +k+++g    +sk+hd+k+felskkiWgs
  PK08229.1 170 HQRLWSDDDEIEILKGLIDYQSKKGKDPTADMSAFLDFIKKNLHVDVEKRQLSTKISRLKKKYFSNAEKVEKG--EILSKPHDRKSFELSKKIWGS 263
                69*******************************************************************5555..5699***************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045045.0E-32171262IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MAPRRLKEAP PPADSSSDES ESESEAGIEE ENGVAAEADN GERSSQHEED DDEEEDDDDD  60
EEEEEKEKLS LTNTKEESDS GSDSETDSDS VSDDTAPPSP TTADFTIKPS KSIDDSVQSK  120
VKKPTKANVS IPAPASTPPP KRAAEKDLEG INSKKKKGTA EEDLKQVSSH QRLWSDDDEI  180
EILKGLIDYQ SKKGKDPTAD MSAFLDFIKK NLHVDVEKRQ LSTKISRLKK KYFSNAEKVE  240
KGEILSKPHD RKSFELSKKI WGSINGHGSD DSGKSTKNKS KQIVSNDSEV KTNPNEADDF  300
SSKYPCLTDS LKLVSSISEN LLNQALPLMA SSKLKELENK WRKLHMEGME LQNKRNELTY  360
EQSKLVLKLL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2P5BIA71e-87A0A2P5BIA7_PARAD; DNA-binding storekeeper protein-related transcriptional regulator
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.11e-27DNA-binding storekeeper protein-related transcriptional regulator