PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK08038.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 115aa    MW: 13512.2 Da    PI: 10.2716
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK08038.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+ +++q+G  +W++ ++  g+ R++k+c++rw +yl
        PK08038.1 15 KGPWTPEEDHILISYIQQFGHANWRALPKQAGLLRCGKSCRLRWINYL 62
                     79******************************99************97 PP

2Myb_DNA-binding57.72.7e-1868113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ ++++++ lG++ W++Ia  ++ gRt++++k++w+++l
        PK08038.1  68 RGNFSKEEEDTIIKLHHNLGNR-WSSIATQLP-GRTDNEIKNFWHTHL 113
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.2E-26765IPR009057Homeodomain-like
PROSITE profilePS5129415.8421062IPR017930Myb domain
SuperFamilySSF466891.8E-3012109IPR009057Homeodomain-like
SMARTSM007171.0E-111464IPR001005SANT/Myb domain
PfamPF002493.9E-161562IPR001005SANT/Myb domain
CDDcd001674.69E-91762No hitNo description
PROSITE profilePS5129425.93863115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2666114IPR009057Homeodomain-like
SMARTSM007179.5E-1667115IPR001005SANT/Myb domain
PfamPF002494.3E-1768113IPR001005SANT/Myb domain
CDDcd001675.57E-1170113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MGSRRACCEN MGLRKGPWTP EEDHILISYI QQFGHANWRA LPKQAGLLRC GKSCRLRWIN  60
YLRPDIKRGN FSKEEEDTII KLHHNLGNRW SSIATQLPGR TDNEIKNFWH THLKX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-271011422125MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010102236.12e-69Myb-related protein Myb4
SwissprotQ7XBH42e-67MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLW9RQQ52e-69W9RQQ5_9R
STRINGSb06g022660.17e-67(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.14e-67myb domain protein 15