PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK07873.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family HD-ZIP
Protein Properties Length: 399aa    MW: 44591.8 Da    PI: 7.5768
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK07873.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox573.3e-18218272256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ +++k+q   Lee F+++++++ ++++ LAk+l+L  rqV vWFqNrRa+ k
  PK07873.1 218 RKKLRLSKDQSAFLEESFKEHNTLNPKQKQALAKQLNLRPRQVEVWFQNRRARTK 272
                788899***********************************************98 PP

2HD-ZIP_I/II127.55.6e-41218308192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  +kk+rlsk+q+++LEesF+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
    PK07873.1 218 RKKLRLSKDQSAFLEESFKEHNTLNPKQKQALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELR-ALK 308
                  69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-18194275IPR009057Homeodomain-like
SuperFamilySSF466892.52E-18206275IPR009057Homeodomain-like
PROSITE profilePS5007117.443214274IPR001356Homeobox domain
SMARTSM003899.3E-16216278IPR001356Homeobox domain
PfamPF000461.5E-15218272IPR001356Homeobox domain
CDDcd000864.21E-16218275No hitNo description
PROSITE patternPS000270249272IPR017970Homeobox, conserved site
PfamPF021836.3E-11274308IPR003106Leucine zipper, homeobox-associated
SMARTSM003409.1E-26274317IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MELGLSLGDP PKPFGFIEKH HRDRGRDRDR DRERDHSNND NASPFCMDLS IGPLRSRAED  60
RNGREQELNN KEQERRRDDV SHIEGTGTGT VSSSEPPVQL DLLPHTPVPR THGGSGFPWS  120
ASIENQEGGS SGCGILELNR VSKVVVRTSA AEEADETTVL SSSPNSNSGG TSSFHMDIGL  180
YNYRGSGGNN KRDQYSEGEA ERSSPRASDD DDVNGNNRKK LRLSKDQSAF LEESFKEHNT  240
LNPKQKQALA KQLNLRPRQV EVWFQNRRAR TKLKQTEVDC EYLKRCCETL TEENRRLHKE  300
LQELRALKTS NPFYMQLPAT TLTMCPSCER VATTTTTTNT VTNPNTNPTS NNNNNSESPS  360
SKAAGFPINR PKFYPFPQTQ AQAQSQAQTY THHQSSAAS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12333RGRDRDRDRER
2266274RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010095880.11e-134homeobox-leucine zipper protein HOX11
SwissprotP466655e-88HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A2P5DZS91e-143A0A2P5DZS9_PARAD; Octamer-binding transcription factor
STRINGXP_010095880.11e-134(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-85homeobox from Arabidopsis thaliana